PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G345000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 241aa    MW: 27290.9 Da    PI: 8.1133
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G345000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.8e-181057148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT++Ed++lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
  Sevir.3G345000.1.p 10 KGPWTEQEDLQLVCTVRLFGERRWDFIAKVSGLNRTGKSCRLRWVNYL 57
                        79********************************************97 PP

2Myb_DNA-binding53.55.5e-1763108148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rgr+++ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  Sevir.3G345000.1.p  63 RGRMSPNEERLILELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 108
                         89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.259557IPR017930Myb domain
SMARTSM007171.9E-15959IPR001005SANT/Myb domain
SuperFamilySSF466894.87E-299104IPR009057Homeodomain-like
PfamPF002491.7E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-191164IPR009057Homeodomain-like
CDDcd001677.88E-121257No hitNo description
PROSITE profilePS5129425.61458112IPR017930Myb domain
SMARTSM007172.5E-1562110IPR001005SANT/Myb domain
PfamPF002493.3E-1563107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2365111IPR009057Homeodomain-like
CDDcd001672.41E-1165108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MVTVREETRK GPWTEQEDLQ LVCTVRLFGE RRWDFIAKVS GLNRTGKSCR LRWVNYLHPG  60
LKRGRMSPNE ERLILELHAR WGNRWSRIAR RLPGRTDNEI KNYWRTHMRK KAQERKRNMS  120
PSSSSSSLTY QSCYPDTPST VGVEGQELHG GSGCITSIMK GTPQDMDVYP MDQIWMEIEA  180
PDVPSSMGLD GGNENACSSL AAPLVPPAAW DYYPEAGWKM DDEIKMAPQF GYGEGVGPCF  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-2871121105MYB PROTO-ONCOGENE PROTEIN
1mse_C9e-28101124105C-Myb DNA-Binding Domain
1msf_C9e-28101124105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0391310.0BT039131.1 Zea mays full-length cDNA clone ZM_BFb0374B19 mRNA, complete cds.
GenBankHQ8586750.0HQ858675.1 Zea mays clone UT1131 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962720.11e-180PREDICTED: myb-related protein MYBAS2-like
SwissprotQ4JL761e-135MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLK3Z9831e-180K3Z983_SETIT; Uncharacterized protein
STRINGSi023104m1e-179(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.32e-71myb domain protein 59